Structure of PDB 6s47 Chain AM

Receptor sequence

>6s47AM (length=169) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

QNPMRDLKIEKLVLNISVGESGDRLTRASKVLEQLSGQTPVQSKARYTVR
TFGIRRNEKIAVHVTVRGPKAEEILERGLKVKEYQLRDRNFSATGNFGFG
IDEHIDLGIKYDPSIGIFGMDFYVVMNRPGARVTRRKRCKGTVGNSHKTT
KEDTVSWFKQKYDADVLDK

3D structure

PDB

6s47 A role for the Saccharomyces cerevisiae ABCF protein New1 in translation termination/recycling.

Chain

Resolution

3.28 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AM	K16 V18 N20 S22 S48 A50 R51 F57 H68 N95 F96 S97 T99 F104 G105 I106 D107 G124 D126 Y128	K11 V13 N15 S17 S43 A45 R46 F52 H63 N90 F91 S92 T94 F99 G100 I101 D102 G119 D121 Y123
BS02	rna	AM	M9 Q43 T44 V46 V69 T70 R72 G135 R137 R141 K142 R143 V148 G149 N150 H152	M4 Q38 T39 V41 V64 T65 R67 G130 R132 R136 K137 R138 V143 G144 N145 H147

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6s47, PDBe:6s47, PDBj:6s47
PDBsum	6s47
PubMed	31299085
UniProt	Q3E757\|RL11B_YEAST Large ribosomal subunit protein uL5B (Gene Name=RPL11B)

[Back to BioLiP]