Structure of PDB 5myj Chain AM

Receptor sequence

>5myjAM (length=111) Species: 416870 (Lactococcus cremoris subsp. cremoris MG1363)

ARFAGVDIPNEKRIVISLTYVFGVGLQTSKKVLAAAGVSEDIRTKDLTSD
QEDAIRRELDGLKLEGDLRREVSLNIKRLMEIGSYRGMRHRRGLPTRGQN
TKNNARTRKGP

3D structure

• PDB: 5myj A general mechanism of ribosome dimerization revealed by single-particle cryo-electron microscopy.
• Chain: AM
• Resolution: 5.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AM	I17 T20 F23 G24 G26 L27 Q28 E41 R44 N76 I77 L80 H91 P96 T97 R98 G99 Q100 N101 T102 K103 N104 N105 A106 R107 T108 K110 G111 P112	I16 T19 F22 G23 G25 L26 Q27 E40 R43 N75 I76 L79 H90 P95 T96 R97 G98 Q99 N100 T101 K102 N103 N104 A105 R106 T107 K109 G110 P111
BS02	rna	AM	I77 K78 M81 R92	I76 K77 M80 R91

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5myj, PDBe:5myj, PDBj:5myj
• PDBsum: 5myj
• PubMed: 28959045
• UniProt: A2RNM9|RS13_LACLM Small ribosomal subunit protein uS13 (Gene Name=rpsM)