Structure of PDB 5a9z Chain AM

Receptor sequence

>5a9zAM (length=145) Species: 300852 (Thermus thermophilus HB8)

LRPNPGANKRRKRVGRGPGSGHGKTATRGHKGQKSRSGGLKDPRRFEGGR
STTLMRLPKRGMQGQVPGEIKRPRYQGVNLKDLARFEGEVTPELLVRAGL
LKKGYRLKILGEGEAKPLKVVAHAFSKSALEKLKAAGGEPVLLEA

3D structure

• PDB: 5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
• Chain: AM
• Resolution: 4.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AM	L6 R7 N9 P10 A12 N13 K14 R15 R16 K17 R18 V19 R21 G22 P23 S25 G26 H27 G28 K29 T30 A31 T32 R33 H35 K36 G37 Q38 K39 R41 G44 L45 D47 P48 R49 R50 R55 S56 T57 L59 R61 L62 P63 K64 R65 G66 M67 V71 I75 Y80 L100 V101 A103 G104 L105 R111 K113 L115 G116 S131 K132 S133	L1 R2 N4 P5 A7 N8 K9 R10 R11 K12 R13 V14 R16 G17 P18 S20 G21 H22 G23 K24 T25 A26 T27 R28 H30 K31 G32 Q33 K34 R36 G39 L40 D42 P43 R44 R45 R50 S51 T52 L54 R56 L57 P58 K59 R60 G61 M62 V66 I70 Y75 L95 V96 A98 G99 L100 R106 K108 L110 G111 S126 K127 S128

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
• PDBsum: 5a9z
• PubMed: 26283392
• UniProt: Q5SHQ7|RL15_THET8 Large ribosomal subunit protein uL15 (Gene Name=rplO)