Structure of PDB 4v8z Chain AM

Receptor sequence
>4v8zAM (length=124) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AEVTIEDALKVVLRTALVHDGLARGLRESTKALTRGEALLVVLVSSVTEA
NIIKLVEGLANDPENKVPLIKVADAKQLGEWAGLGKIDREGNARKVVGAS
VVVVKNWGAETDELSMIMEHFSQQ
3D structure
PDB4v8z Molecular architecture of a eukaryotic translational initiation complex.
ChainAM
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AM R43 G44 L45 R46 E47 T67 V116 G117 A118 S119 R24 G25 L26 R27 E28 T48 V97 G98 A99 S100
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0002181 cytoplasmic translation
GO:0006364 rRNA processing
GO:0006412 translation
GO:0030490 maturation of SSU-rRNA
GO:0042274 ribosomal small subunit biogenesis
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v8z, PDBe:4v8z, PDBj:4v8z
PDBsum4v8z
PubMed24200810
UniProtP48589|RS12_YEAST Small ribosomal subunit protein eS12 (Gene Name=RPS12)

[Back to BioLiP]