Structure of PDB 4v7c Chain AM

Receptor sequence
>4v7cAM (length=114) Species: 562 (Escherichia coli) [Search protein sequence]
ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKP
3D structure
PDB4v7c Structure of the ribosome with elongation factor G trapped in the pretranslocation state.
ChainAM
Resolution7.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AM H13 I16 Y22 G23 V24 G25 T27 R28 S75 Y85 R86 H90 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 K109 R112 P114 H13 I16 Y22 G23 V24 G25 T27 R28 S75 Y85 R86 H90 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 K109 R112 P114
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v7c, PDBe:4v7c, PDBj:4v7c
PDBsum4v7c
PubMed24324137
UniProtP0A7S9|RS13_ECOLI Small ribosomal subunit protein uS13 (Gene Name=rpsM)

[Back to BioLiP]