Structure of PDB 4v6u Chain AM

Receptor sequence
>4v6uAM (length=133) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
QVNIKKKEKWGIAHIYSSFNNTIIHITDITGAETISRWSGGMVVKADRDE
PSPYAAMLAARRAAEEALEKGIVGVHIRVRAPGGSKSKTPGPGAQAAIRA
LARAGLKIGRVEDVTPIPHDGTRPKGGRRGRRV
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainAM
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AM K49 R52 K45 R48
BS02 rna AM H18 Y20 N24 N25 H29 G35 E37 T38 S43 G45 M46 D51 R52 E54 P122 H123 D124 G125 R127 K129 G131 R132 R133 R135 R136 V137 H14 Y16 N20 N21 H25 G31 E33 T34 S39 G41 M42 D47 R48 E50 P118 H119 D120 G121 R123 K125 G127 R128 R129 R131 R132 V133
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtQ8U0E3|RS11_PYRFU Small ribosomal subunit protein uS11 (Gene Name=rps11)

[Back to BioLiP]