Structure of PDB 4v6m Chain AM

Receptor sequence

>4v6mAM (length=117) Species: 83333 (Escherichia coli K-12) [Search protein sequence]

ARIAGINIPDHKHAVIALTSIYGVGKTRSKAILAAAGIAEDVKISELSEG
QIDTLRDEVAKFVVEGDLRREISMSIKRLMDLGCYRGLRHRRGLPVRGQR
TKTNARTRKGPRKPIKK

3D structure

PDB

4v6m Cryo-EM structure of the ribosome-SecYE complex in the membrane environment.

Chain

Resolution

7.1 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AM	H11 K12 H13 I16 Y22 G23 V24 G25 T27 R28 K43 I76 Y85 H90 R92 L94 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113 I115 K116 K117	H11 K12 H13 I16 Y22 G23 V24 G25 T27 R28 K43 I76 Y85 H90 R92 L94 P95 V96 R97 Q99 R100 T101 K102 T103 N104 A105 R106 T107 R108 K109 R112 K113 I115 K116 K117
BS02	rna	AM	M80 D81 L88 R91	M80 D81 L88 R91

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

External links

PDB	RCSB:4v6m, PDBe:4v6m, PDBj:4v6m
PDBsum	4v6m
PubMed	21499241
UniProt	P0ADZ4\|RS15_ECOLI Small ribosomal subunit protein uS15 (Gene Name=rpsO)