Structure of PDB 4bts Chain AM

Receptor sequence

>4btsAM (length=153) Species: 5911 (Tetrahymena thermophila) [Search protein sequence]

SFVIEKESDFKYIHRILNTNIDGKRITPIALTGIRGIGRRFAYIICKVLK
IDPNARAGLLTEDQCNKITDLIADPEAHGIPTWLLNRINDFKDGKNYQMA
SNTLDTKMREDLERLKKIKSHRGLRHFWGLKVRGQHTKTSGRHGVVCGVV
RKN

3D structure

PDB

4bts The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.

Chain

Resolution

3.703 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AM	R26 I30 R36 G37 I38 G39 R41 F42 W84 L85 L86 N87 I89 M109 H122 R123 R126 H127 L131 K132 V133 R134 G135 Q136 H137 T138 K139 T140 S141 G142 R143 H144 C148 G149 V151 K153	R25 I29 R35 G36 I37 G38 R40 F41 W83 L84 L85 N86 I88 M108 H121 R122 R125 H126 L130 K131 V132 R133 G134 Q135 H136 T137 K138 T139 S140 G141 R142 H143 C147 G148 V150 K152

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4bts, PDBe:4bts, PDBj:4bts
PDBsum	4bts
PubMed	23851459
UniProt	E6PBT6

[Back to BioLiP]