Structure of PDB 1vy6 Chain AM

Receptor sequence

>1vy6AM (length=123) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]

ARIAGVEIPRNKRVDVALTYIYGIGKARAKEALEKTGINPATRVKDLTEA
EVVRLREYVENTWKLEGELRAEVAANIKRLMDIGCYRGLRHRRGLPVRGQ
RTRTNARTRKGPRKTVAGKKKAP

3D structure

PDB

1vy6 A proton wire to couple aminoacyl-tRNA accommodation and peptide-bond formation on the ribosome.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AM	K13 R14 V17 Y21 Y23 G24 I25 G26 A28 R29 R44 V74 N77 I78 Y87 R88 R91 H92 P97 V98 R99 Q101 R102 T103 R104 T105 N106 A107 R108 T109 K111 R114 K115 T116 K120	K12 R13 V16 Y20 Y22 G23 I24 G25 A27 R28 R43 V73 N76 I77 Y86 R87 R90 H91 P96 V97 R98 Q100 R101 T102 R103 T104 N105 A106 R107 T108 K110 R113 K114 T115 K119
BS02	rna	AM	D83 R93	D82 R92
BS03	MG	AM	T20 I22 Y23 I25	T19 I21 Y22 I24

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

External links

PDB	RCSB:1vy6, PDBe:1vy6, PDBj:1vy6
PDBsum	1vy6
PubMed	25132179
UniProt	P80377\|RS13_THET8 Small ribosomal subunit protein uS13 (Gene Name=rpsM)