Structure of PDB 8hkz Chain ALX0

Receptor sequence
>8hkzALX0 (length=76) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]
VKIFMVRGTAIFSASRFPTSQKFTKYVRALNEKQAIEYIYSQLGGKNKIK
RYNIHIQEIKEVKEDEITDKTIRDLA
3D structure
PDB8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
ChainALX0
Resolution4.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna ALX0 T22 S23 Q24 K25 F26 T27 K28 E40 Y41 Y43 S44 Q45 G47 K49 N50 K51 K53 R54 K73 T19 S20 Q21 K22 F23 T24 K25 E37 Y38 Y40 S41 Q42 G44 K46 N47 K48 K50 R51 K70
BS02 rna ALX0 I14 Y55 I11 Y52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum8hkz
PubMed37604686
UniProtP38613|RL18A_SULAC Large ribosomal subunit protein eL20 (Gene Name=rpl18a)

[Back to BioLiP]