Structure of PDB 8hkz Chain AL5P

Receptor sequence

>8hkzAL5P (length=168) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

KENVMRRVVLDKVTVNIGVGESGERLQKAYQLVQELTGVKPVYTKGRKSI
REFGVRKGAPIGVKATLRRQAAVEFLKKVLPAVNFRLKQSSFDNYGNVSF
GIAEHVLIPGTRYDPEIGIFGMDVAITLVRPGYRTMKRKRKKASIPRRHR
VTKEEAINFMKENFNVTI

3D structure

PDB

8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.

Chain

AL5P

Resolution

4.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL5P	N23 G25 V26 G27 T51 G53 R54 I57 F60 V62 K71 S97 S98 F99 D100 Y102 N104 S106 G108 A110 G128 D130 R157	N16 G18 V19 G20 T44 G46 R47 I50 F53 V55 K64 S90 S91 F92 D93 Y95 N97 S99 G101 A103 G121 D123 R150
BS02	rna	AL5P	K8 E9 V11 M12 V46 K47 P48 V49 T73 R75 R76 R141 K144 R145 K146 R147 I152 P153 R154 R155 H156	K1 E2 V4 M5 V39 K40 P41 V42 T66 R68 R69 R134 K137 R138 K139 R140 I145 P146 R147 R148 H149

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
PDBsum	8hkz
PubMed	37604686
UniProt	P41202\|RL5_SULAC Large ribosomal subunit protein uL5 (Gene Name=rpl5)

[Back to BioLiP]