Structure of PDB 8hku Chain AL5P

Receptor sequence

>8hkuAL5P (length=168) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

KENVMRRVVLDKVTVNIGVGESGERLQKAYQLVQELTGVKPVYTKGRKSI
REFGVRKGAPIGVKATLRRQAAVEFLKKVLPAVNFRLKQSSFDNYGNVSF
GIAEHVLIPGTRYDPEIGIFGMDVAITLVRPGYRTMKRKRKKASIPRRHR
VTKEEAINFMKENFNVTI

3D structure

• PDB: 8hku Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: AL5P
• Resolution: 2.72 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL5P	N23 G27 R54 K55 E59 F60 S98 G108 G128 D130 R157	N16 G20 R47 K48 E52 F53 S91 G101 G121 D123 R150
BS02	rna	AL5P	E9 M12 K47 V49 K52 K71 A72 T73 R75 G139 R141 R145 K146 K148 A150 I152 P153 R155 H156	E2 M5 K40 V42 K45 K64 A65 T66 R68 G132 R134 R138 K139 K141 A143 I145 P146 R148 H149

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hku, PDBe:8hku, PDBj:8hku
• PDBsum: 8hku
• PubMed: 37604686
• UniProt: P41202|RL5_SULAC Large ribosomal subunit protein uL5 (Gene Name=rpl5)