Structure of PDB 8hkz Chain AL4P

Receptor sequence

>8hkzAL4P (length=251) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

KVSVLDLKGNQLEEIELPLFFSYPVRKDLIRRVFLSEFTKSLQPKGRDPL
AGKRTSALSFGINLGIARVPRVKGSGEAALAPNTVGGRLAFPPTTEKRLV
EEVNLKEKKLGIISALAATADPNFVKARGHRFTSNNVPIILVDDFENISK
AKEIMDILKSIGVVDDIKRVKESKGVRAGKGKMRGRRYQIAKGPLIVVSN
HKSPVVESASNIPGVNVVSANLVSVIHLAPGGHPGRLTIYTKSSINILRQ
R

3D structure

• PDB: 8hkz Cryo-electron microscopy structure and translocation mechanism of the crenarchaeal ribosome.
• Chain: AL4P
• Resolution: 4.78 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL4P	R34 R39 E45 K48 S49 L50 Q51 K53 G54 R55 D56 A59 G60 R62 T63 S64 N71 R76 V77 R79 N91 V93 R96 L97 F99 E104 K105 R106 E110 L113 K114 E115 K116 R136 K158 K160 R177 K179 K182 V184 R185 A186 G187 K188 K190 M191 R192 R194 R195 Q197 A199 K200 H209 V214 E215 S218 N219 L230 S232 G239	R26 R31 E37 K40 S41 L42 Q43 K45 G46 R47 D48 A51 G52 R54 T55 S56 N63 R68 V69 R71 N83 V85 R88 L89 F91 E96 K97 R98 E102 L105 K106 E107 K108 R128 K150 K152 R169 K171 K174 V176 R177 A178 G179 K180 K182 M183 R184 R186 R187 Q189 A191 K192 H201 V206 E207 S210 N211 L222 S224 G231

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hkz, PDBe:8hkz, PDBj:8hkz
• PDBsum: 8hkz
• PubMed: 37604686
• UniProt: Q4JB41|RL4_SULAC Large ribosomal subunit protein uL4 (Gene Name=rpl4)