Structure of PDB 8hkv Chain AL3P

Receptor sequence

>8hkvAL3P (length=339) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

RKLSSPRRGSAGLRPRKRADEILPTPKNWPLVNLKEPKLLGFIGYKAGMT
HVYMIDDKPTSPNYGKEVYTPVTIVESPPILGLALRAYHIDSKGELSVLV
DYWANFEEGSLKYLKRKITSLKVDSSKMKEKLDLIQKNLNNITYMRLLVS
TQPWLVPSLGKKRPEIVEIQIGGGSIQDQLNYGLSLLGKQIPVRDVFREG
QLTDIIGVTKGKGFQGVIKRYSVVEFPRWHKHRKGSRKIGARGPSISTPS
YVPQPGQLGFHRRTEYNKRIIKIGDNVNEINPAGGIVNYGLVKNTYLVIE
GSVLGSRKRPLFLRYPIRPSWSPESAPKITYVNLASQQG

3D structure

PDB

8hkv Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

AL3P

Resolution

4.94 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL3P	K5 S7 R10 R11 S13 G15 L16 R17 P18 R19 K20 R21 E24 I25 K30 N31 M52 T53 H54 T63 P65 P74 R89 Y91 L99 S100 V101 L102 D104 K115 R119 I121 K125 R149 G163 K164 K165 R166 I169 E171 T212 K213 G214 K215 G216 F217 Q218 G219 I221 V227 E228 F229 P230 R231 W232 H233 H235 R236 K237 S239 R240 K241 I242 G243 A244 R245 P247 S248 I249 S250 P252 Y254 V255 Q260 R265 R266 T267 E268 Y269 N270 K271 G287 N291 G293 L294 G304 S305 V306 L307 G308 S309 R310 R312 R321 S339 Q341 G342	K2 S4 R7 R8 S10 G12 L13 R14 P15 R16 K17 R18 E21 I22 K27 N28 M49 T50 H51 T60 P62 P71 R86 Y88 L96 S97 V98 L99 D101 K112 R116 I118 K122 R146 G160 K161 K162 R163 I166 E168 T209 K210 G211 K212 G213 F214 Q215 G216 I218 V224 E225 F226 P227 R228 W229 H230 H232 R233 K234 S236 R237 K238 I239 G240 A241 R242 P244 S245 I246 S247 P249 Y251 V252 Q257 R262 R263 T264 E265 Y266 N267 K268 G284 N288 G290 L291 G301 S302 V303 L304 G305 S306 R307 R309 R318 S336 Q338 G339

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hkv, PDBe:8hkv, PDBj:8hkv
PDBsum	8hkv
PubMed	37604686
UniProt	Q4JB40\|RL3_SULAC Large ribosomal subunit protein uL3 (Gene Name=rpl3)

[Back to BioLiP]