Structure of PDB 9bdn Chain AL39

Receptor sequence

>9bdnAL39 (length=50) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

SSHKTFRIKRFLAKKQKQNRPIPQWIWMKTGNKIRYNSKRRHWRRTKLGL

3D structure

PDB

9bdn Structural mechanism of angiogenin activation by the ribosome.

Chain

AL39

Resolution

3.1 Å

3D
structure

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL39	S2 S3 H4 K5 K10 L13 Q17 P22 I35 R36 Y37 N38 S39 R41 R42 H43 W44 R45 K48 L49 L51	S1 S2 H3 K4 K9 L12 Q16 P21 I34 R35 Y36 N37 S38 R40 R41 H42 W43 R44 K47 L48 L50
BS02	rna	AL39	R8 K15 K18 R21 I23 W26 I27 M29 K30 T31 I35 N38 K40	R7 K14 K17 R20 I22 W25 I26 M28 K29 T30 I34 N37 K39

Gene Ontology

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links