Structure of PDB 9bdp Chain AL35

Receptor sequence

>9bdpAL35 (length=122) Species: 9986 (Oryctolagus cuniculus)

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

3D structure

• PDB: 9bdp Structural mechanism of angiogenin activation by the ribosome.
• Chain: AL35
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL35	R70 K74 K77 Y78 R84 P85 K87 R89 R94 L95 N96 K97 K106 R109 K110 R112 L113	R69 K73 K76 Y77 R83 P84 K86 R88 R93 L94 N95 K96 K105 R108 K109 R111 L112
BS02	rna	AL35	K5 K35 S42 L44 S45 R48 R51 K52 A55 R56 L58 T59 N62 Q63 K66 R70 L81 R84 K86 T88 R89 R92	K4 K34 S41 L43 S44 R47 R50 K51 A54 R55 L57 T58 N61 Q62 K65 R69 L80 R83 K85 T87 R88 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:9bdp, PDBe:9bdp, PDBj:9bdp
• PDBsum: 9bdp
• PubMed: 38718836
• UniProt: G1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)