Structure of PDB 6n1d Chain AL34

Receptor sequence
>6n1dAL34 (length=48) Species: 274 (Thermus thermophilus) [Search protein sequence]
MKRTWQPNRRKRAKTHGFRARMRTPGGRKVLKRRRQKGRWRLTPAVRK
3D structure
PDB6n1d Spontaneous ribosomal translocation of mRNA and tRNAs into a chimeric hybrid state.
ChainAL34
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL34 M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 R12 A13 K14 H16 G17 F18 R19 R21 R23 G26 R28 K29 R33 R34 R35 K37 R39 W40 R47 M1 K2 R3 T4 W5 Q6 P7 N8 R9 R10 R12 A13 K14 H16 G17 F18 R19 R21 R23 G26 R28 K29 R33 R34 R35 K37 R39 W40 R47
BS02 MG AL34 K14 A20 R23 K14 A20 R23
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6n1d, PDBe:6n1d, PDBj:6n1d
PDBsum6n1d
PubMed30936299
UniProtP80340|RL34_THET8 Large ribosomal subunit protein bL34 (Gene Name=rpmH)

[Back to BioLiP]