Structure of PDB 4xej Chain AL33

Receptor sequence
>4xejAL33 (length=44) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
LLLECTECKRRNYATEKNKRNTPNKLELRKYCPWCRKHTVHREV
3D structure
PDB4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
ChainAL33
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL33 E12 R19 E24 K25 K27 T30 Y39 W42 K45 H46 E4 R11 E16 K17 K19 T22 Y31 W34 K37 H38
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum4xej
PubMed25652826
UniProtQ72GW3|RL33_THET2 Large ribosomal subunit protein bL33 (Gene Name=rpmG)

[Back to BioLiP]