Structure of PDB 8hl4 Chain AL2P

Receptor sequence

>8hl4AL2P (length=234) Species: 330779 (Sulfolobus acidocaldarius DSM 639) [Search protein sequence]

GKKLLQQRAGRGGINFRSPSWRRVGPARYPNIEGDHKGKIIDILHNPGVT
APVVKVKLDNGLQFYIPAVQGVAVGQEISIGKNATISNGNIVEVGQLPEG
TVICNVEKLKGDGGKFARAAGSYAVISGKAGNKVLIKLSSEKIVEVSQNA
RATVGIIAGGGFVEKPLLKAGNNYWKYRVRAVKWPVVRGVAMNAVSHPHG
GGLHQSVSRPSTVSRNAPPGRKVGHIASRRTGRR

3D structure

PDB

8hl4 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome

Chain

AL2P

Resolution

4.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL2P	G2 K4 Q7 Q8 R9 G11 R12 I15 N16 R18 S19 S21 W22 R23 R24 G26 P27 R29 P48 K109 K116 F117 A118 R119 A120 A121 G122 L139 S140 S141 K143 F163 V164 K166 L168 L169 K170 A171 G172 N173 W176 R179 R181 V183 W185 P186 V187 V188 R189 G190 V191 A192 M193 N194 V196 G202 G203 H205 Q206 S209 R210 P211 T213 V214 S215 R216 N217 P219 P220 R222 G225 H226 I227 A228 S229 R230 R231 T232 G233 R234 R235	G1 K3 Q6 Q7 R8 G10 R11 I14 N15 R17 S18 S20 W21 R22 R23 G25 P26 R28 P47 K108 K115 F116 A117 R118 A119 A120 G121 L138 S139 S140 K142 F162 V163 K165 L167 L168 K169 A170 G171 N172 W175 R178 R180 V182 W184 P185 V186 V187 R188 G189 V190 A191 M192 N193 V195 G201 G202 H204 Q205 S208 R209 P210 T212 V213 S214 R215 N216 P218 P219 R221 G224 H225 I226 A227 S228 R229 R230 T231 G232 R233 R234

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8hl4, PDBe:8hl4, PDBj:8hl4
PDBsum	8hl4
PubMed	37604686
UniProt	Q4JB43\|RL2_SULAC Large ribosomal subunit protein uL2 (Gene Name=rpl2)

[Back to BioLiP]