Structure of PDB 8hl3 Chain AL2P

Receptor sequence

>8hl3AL2P (length=234) Species: 330779 (Sulfolobus acidocaldarius DSM 639)

GKKLLQQRAGRGGINFRSPSWRRVGPARYPNIEGDHKGKIIDILHNPGVT
APVVKVKLDNGLQFYIPAVQGVAVGQEISIGKNATISNGNIVEVGQLPEG
TVICNVEKLKGDGGKFARAAGSYAVISGKAGNKVLIKLSSEKIVEVSQNA
RATVGIIAGGGFVEKPLLKAGNNYWKYRVRAVKWPVVRGVAMNAVSHPHG
GGLHQSVSRPSTVSRNAPPGRKVGHIASRRTGRR

3D structure

• PDB: 8hl3 Cryo-EM Structures and Translocation Mechanism of Crenarchaeota Ribosome
• Chain: AL2P
• Resolution: 4.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL2P	G2 K3 K4 Q7 Q8 R9 G11 R12 N16 R18 S21 W22 R24 G26 P27 R29 N32 P48 K116 F117 A118 R119 A120 A121 G122 S123 L139 S140 S141 K143 F163 V164 K166 L168 L169 K170 G172 W176 K177 R179 V183 K184 V187 V188 R189 G190 V191 M193 N194 V196 G202 G203 L204 H205 S209 R210 P211 S212 T213 V214 S215 R216 N217 P219 P220 R222 K223 V224 G225 H226 I227 S229 R230 R231 T232 G233 R234 R235	G1 K2 K3 Q6 Q7 R8 G10 R11 N15 R17 S20 W21 R23 G25 P26 R28 N31 P47 K115 F116 A117 R118 A119 A120 G121 S122 L138 S139 S140 K142 F162 V163 K165 L167 L168 K169 G171 W175 K176 R178 V182 K183 V186 V187 R188 G189 V190 M192 N193 V195 G201 G202 L203 H204 S208 R209 P210 S211 T212 V213 S214 R215 N216 P218 P219 R221 K222 V223 G224 H225 I226 S228 R229 R230 T231 G232 R233 R234

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8hl3, PDBe:8hl3, PDBj:8hl3
• PDBsum: 8hl3
• PubMed: 37604686
• UniProt: Q4JB43|RL2_SULAC Large ribosomal subunit protein uL2 (Gene Name=rpl2)