Structure of PDB 6n1d Chain AL28

Receptor sequence

>6n1dAL28 (length=88) Species: 262724 (Thermus thermophilus HB27)

SGKRPIVANSIQRRGKAKREGGVGKKTTGISKRRQYPNLQKVRVRVAGQE
ITFRVAASHIPKVYELVERAKGLRLEGLSPKEIKKELL

3D structure

• PDB: 6n1d Spontaneous ribosomal translocation of mRNA and tRNAs into a chimeric hybrid state.
• Chain: AL28
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL28	S8 Q19 R21 G22 K23 K25 R26 G29 V30 G31 K32 K33 T35 I37 S38 K39 R40 R41 Q42 Y43 P44 N45 Q47 R50 S65 H66 R76 K78 G79 R81 K92	S1 Q12 R14 G15 K16 K18 R19 G22 V23 G24 K25 K26 T28 I30 S31 K32 R33 R34 Q35 Y36 P37 N38 Q40 R43 S58 H59 R69 K71 G72 R74 K85
BS02	MG	AL28	G29 V30	G22 V23

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n1d, PDBe:6n1d, PDBj:6n1d
• PDBsum: 6n1d
• PubMed: 30936299
• UniProt: Q72G84|RL28_THET2 Large ribosomal subunit protein bL28 (Gene Name=rpmB)