Structure of PDB 7top Chain AL26

Receptor sequence

>7topAL26 (length=126) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIR
RDDEVLVVRGSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHP
SKLVITKLHLDKDRKALIQRKGGKLE

3D structure

PDB

7top Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.

Chain

AL26

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL26	A2 K3 Q4 S5 L6 D7 V8 S9 S10 R12 K14 A15 R16 Y19 V29 L30 S32 P34 R40 R60 G61 S62 K87 K89 V90 N91 H100 S102 K103 R121 K122	A1 K2 Q3 S4 L5 D6 V7 S8 S9 R11 K13 A14 R15 Y18 V28 L29 S31 P33 R39 R59 G60 S61 K86 K88 V89 N90 H99 S101 K102 R120 K121
BS02	rna	AL26	R12 R13 R16 K17 F20 P23 S24 S25 R28 R51 R52 V73 Y74 R75 L111 D112 K113 D114 K116	R11 R12 R15 K16 F19 P22 S23 S24 R27 R50 R51 V72 Y73 R74 L110 D111 K112 D113 K115

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0042273	ribosomal large subunit biogenesis

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:0032991	protein-containing complex
GO:0043232	intracellular non-membrane-bounded organelle
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7top, PDBe:7top, PDBj:7top
PDBsum	7top
PubMed	35589706
UniProt	P05743\|RL26A_YEAST Large ribosomal subunit protein uL24A (Gene Name=RPL26A)