Structure of PDB 4xej Chain AL24

Receptor sequence
>4xejAL24 (length=100) Species: 262724 (Thermus thermophilus HB27) [Search protein sequence]
RVKMHVKKGDTVLVASGKYKGRVGKVKEVLPKKYAVIVEGVNIVKKAVRV
SPKYPQGGFIEKEAPLHASKVRPICPACGKPTRVRKKFLENGKKIRVCAK
3D structure
PDB4xej Initiation of translation in bacteria by a structured eukaryotic IRES RNA.
ChainAL24
Resolution3.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL24 R2 V3 M5 K9 S17 G18 K19 V30 P32 K33 Y35 I44 K46 K47 V49 S52 K54 H68 S70 K71 R73 P82 R84 V85 R1 V2 M4 K8 S16 G17 K18 V29 P31 K32 Y34 I43 K45 K46 V48 S51 K53 H67 S69 K70 R72 P81 R83 V84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4xej, PDBe:4xej, PDBj:4xej
PDBsum4xej
PubMed25652826
UniProtQ72I15|RL24_THET2 Large ribosomal subunit protein uL24 (Gene Name=rplX)

[Back to BioLiP]