Structure of PDB 6n1d Chain AL23

Receptor sequence

>6n1dAL23 (length=92) Species: 262724 (Thermus thermophilus HB27)

TAYDVILAPVLSEKAYAGFAEGKYTFWVHPKATKTEIKNAVETAFKVKVV
KVNTLHVRGKKKRLGRYLGKRPDRKKAIVQVAPGQKIEALEG

3D structure

• PDB: 6n1d Spontaneous ribosomal translocation of mRNA and tRNAs into a chimeric hybrid state.
• Chain: AL23
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL23	E23 K25 T35 K36 T37 E38 K40 N41 K50 K53 N55 T56 L57 H58 R60 K63 K64 R65 Y69 L70 G71 K72 P74 D75 K78 I80	E21 K23 T33 K34 T35 E36 K38 N39 K48 K51 N53 T54 L55 H56 R58 K61 K62 R63 Y67 L68 G69 K70 P72 D73 K76 I78
BS02	MG	AL23	A17 F21 K25 Y26 T27	A15 F19 K23 Y24 T25

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6n1d, PDBe:6n1d, PDBj:6n1d
• PDBsum: 6n1d
• PubMed: 30936299
• UniProt: Q72I06|RL23_THET2 Large ribosomal subunit protein uL23 (Gene Name=rplW)