Structure of PDB 9bdn Chain AL10

Receptor sequence

>9bdnAL10 (length=205) Species: 9986 (Oryctolagus cuniculus)

GRRPARCYRYCKNKPYPKSRFCRGVPDAKIRIFDLGRKKAKVDEFPLCGH
MVSDEYEQLSSEALEAARICANKYMVKSCGKDGFHIRVRLHPFHVIRINK
MLQTGMRGAFGKPQGTVARVHIGQVIMSIRTKLQNKEHVVEALRRAKFKF
PGRQKIHISKKWGFTKFNADEFEDMVAEKRLIPDGCGVKYIPNRGPLDKW
RALHS

3D structure

• PDB: 9bdn Structural mechanism of angiogenin activation by the ribosome.
• Chain: AL10
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL10	R3 R4 A6 R7 C8 K13 N14 K15 P16 Y17 F22 R24 D35 K39 E63 R88 R90 H92 F94 R98 N100 M115 R116 G117 A118 F119 G120 F157 K158 P160 D193	R2 R3 A5 R6 C7 K12 N13 K14 P15 Y16 F21 R23 D34 K38 E62 R87 R89 H91 F93 R97 N99 M106 R107 G108 A109 F110 G111 F148 K149 P151 D184
BS02	rna	AL10	Y11 Y57 Y199 N202 R203 G204 P205 L206	Y10 Y56 Y190 N193 R194 G195 P196 L197
BS03	rna	AL10	L103 K121	L102 K112

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000027 ribosomal large subunit assembly
• GO:0006417 regulation of translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:9bdn, PDBe:9bdn, PDBj:9bdn
• PDBsum: 9bdn
• PubMed: 38718836
• UniProt: B7NZQ2|RL10_RABIT Large ribosomal subunit protein uL16 (Gene Name=RPL10)