Structure of PDB 7tor Chain AL07

Receptor sequence

>7torAL07 (length=225) Species: 9986 (Oryctolagus cuniculus)

NFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNT
LIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN

3D structure

• PDB: 7tor Ribosome inhibition by C9ORF72-ALS/FTD-associated poly-PR and poly-GR proteins revealed by cryo-EM.
• Chain: AL07
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL07	N23 F24 K28 K30 R31 R42 R45 R46 K47 Y50 E51 H57 K58 Y60 R61 Q62 Y64 I68 R69 R72 M73 R75 K76 A77 R95 G96 I97 N98 P102 K103 K106 L110 R112 Q115 I116 K123 K126 A127 N130 M131 N145 K147 K155 K163 K164 R165 A175 R176 G179 I184 E187 K201 N205 K211 L212 S213 S214 P215 R216 G217 G218 M219 K222 R241	N1 F2 K6 K8 R9 R20 R23 R24 K25 Y28 E29 H35 K36 Y38 R39 Q40 Y42 I46 R47 R50 M51 R53 K54 A55 R73 G74 I75 N76 P80 K81 K84 L88 R90 Q93 I94 K101 K104 A105 N108 M109 N123 K125 K133 K141 K142 R143 A153 R154 G157 I162 E165 K179 N183 K189 L190 S191 S192 P193 R194 G195 G196 M197 K200 R219
BS02	rna	AL07	R133 E136 K221 T223 T224 H225 E228	R111 E114 K199 T201 T202 H203 E206

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7tor, PDBe:7tor, PDBj:7tor
• PDBsum: 7tor
• PubMed: 35589706
• UniProt: G1SV32|RL7_RABIT Large ribosomal subunit protein uL30 (Gene Name=RPL7)