Structure of PDB 9bdn Chain AL06

Receptor sequence

>9bdnAL06 (length=216) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

KGKPHCSRNPVLVRGIGRYSRSAMYSRKALYKRKYAALATVTKPVGGGTR
VVKLRKMPRYYPTEDVPRKLLSHGKKPFSQHVRKLRASITPGTILIILTG
RHRGKRVVFLKQLSSGLLLVTGPLSLNRVPLRRTHQKFVIATSTKIDISG
VKIPKHLTDAYFKKKKKYEITEQRKVDQKAVDSQILPKIKAVPQLQGYLR
SVFALTNGVYPHKLVF

3D structure

PDB

9bdn Structural mechanism of angiogenin activation by the ribosome.

Chain

AL06

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL06	K41 P44 H45 C46 R48 N49 R54 S60 R61 S62 M64 Y65 S66 K68 Y71 K72 R73 K74 Y75 P98 V99 G100 G105 R108 V110 R113 K114 P116 R117 Y118 V124 R126 K127 L128 L129 S130 H131 K133 K134 P135 F136 S137 H139 K142 T157 R159 R161 L182 L184 R186 P188 R190 R191 H193 F220 K222 Y243 I245 K265 P268 Q269 R275 V277 N282	K1 P4 H5 C6 R8 N9 R14 S20 R21 S22 M24 Y25 S26 K28 Y31 K32 R33 K34 Y35 P44 V45 G46 G47 R50 V52 R55 K56 P58 R59 Y60 V66 R68 K69 L70 L71 S72 H73 K75 K76 P77 F78 S79 H81 K84 T99 R101 R103 L124 L126 R128 P130 R132 R133 H135 F162 K164 Y168 I170 K190 P193 Q194 R200 V202 N207

External links

PDB	RCSB:9bdn, PDBe:9bdn, PDBj:9bdn
PDBsum	9bdn
PubMed	38718836
UniProt	G1SKF7\|RL6_RABIT Large ribosomal subunit protein eL6 (Gene Name=RPL6)

[Back to BioLiP]