Structure of PDB 8q5i Chain AL

Receptor sequence
>8q5iAL (length=77) Species: 5476 (Candida albicans) [Search protein sequence]
AREIKDIKEFVELARRSDIKSAIVKVNAKVNANGKKFKQTKFKVRGSRYQ
YTLVVNDASKAKKLQQSLPPTLKITNL
3D structure
PDB8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy
ChainAL
Resolution2.45 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL A2 R3 E4 R17 D19 K26 N28 K42 K44 R46 S48 R49 Y50 Q51 T53 L78 A1 R2 E3 R16 D18 K25 N27 K41 K43 R45 S47 R48 Y49 Q50 T52 L77
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:0030445 yeast-form cell wall
GO:0030446 hyphal cell wall
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum8q5i
PubMed
UniProtA0A1D8PG16|RL38_CANAL Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]