Structure of PDB 8oir Chain AL

Receptor sequence

>8oirAL (length=174) Species: 9606 (Homo sapiens)

LDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFM
KKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQ
RKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIR
VFQETQKLKKRRRALKAAAAAQKQ

3D structure

• PDB: 8oir Molecular basis of translation termination at noncanonical stop codons in human mitochondria.
• Chain: AL
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	N99 K100 R123 R128 L132 K135 Y139 H142 H146 K148 D149 K150 H152 R154 Y155 L157 M158 S159 D161 Q162 K165 K168 P192 Y195 Y196 R197 R198 H200 R201 R202 F203 K206 C210 F214 R225	N37 K38 R61 R66 L70 K73 Y77 H80 H84 K86 D87 K88 H90 R92 Y93 L95 M96 S97 D99 Q100 K103 K106 P130 Y133 Y134 R135 R136 H138 R139 R140 F141 K144 C148 F152 R163

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8oir, PDBe:8oir, PDBj:8oir
• PDBsum: 8oir
• PubMed: 37141370
• UniProt: P82914|RT15_HUMAN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)