Structure of PDB 8ewb Chain AL

Receptor sequence

>8ewbAL (length=193) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

3D structure

PDB

8ewb Regulation of translation by ribosomal RNA pseudouridylation.

Chain

Resolution

2.87 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	I3 K5 L7 P8 L10 K11 N12 H13 F14 R15 K16 H17 W18 Q19 K23 Q28 A29 K31 K32 R35 R36 R39 R42 R55 V58 R59 P61 T62 Y65 N66 K68 R70 G72 R73 L77 T86 R91 D98 H99 R100 R101 R104 N129 K131 F167 R168 R171 R174 S175 K177 K178 F179 R183 K185	I2 K4 L6 P7 L9 K10 N11 H12 F13 R14 K15 H16 W17 Q18 K22 Q27 A28 K30 K31 R34 R35 R38 R41 R54 V57 R58 P60 T61 Y64 N65 K67 R69 G71 R72 L76 T85 R90 D97 H98 R99 R100 R103 N128 K130 F166 R167 R170 R173 S174 K176 K177 F178 R182 K184
BS02	rna	AL	F26 D27 S34	F25 D26 S33

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8ewb, PDBe:8ewb, PDBj:8ewb
PDBsum	8ewb
PubMed	37595043
UniProt	Q12690\|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)

[Back to BioLiP]