Structure of PDB 8bqd Chain AL

Receptor sequence
>8bqdAL (length=50) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AAQKSFRIKQKMAKAKKQNRPLPQWIRLRTNNTIRYNAKRRNWRRTKMNI
3D structure
PDB8bqd The dynamic architecture of Map1- and NatB-ribosome complexes coordinates the sequential modifications of nascent polypeptide chains.
ChainAL
Resolution3.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL A2 A3 Q4 K5 K10 M13 K17 P22 T34 R36 Y37 K40 R41 R42 W44 R45 T47 K48 A1 A2 Q3 K4 K9 M12 K16 P21 T33 R35 Y36 K39 R40 R41 W43 R44 T46 K47
BS02 rna AL F7 R8 K12 K15 K18 Q19 R21 L23 W26 I27 R30 T31 N38 K40 F6 R7 K11 K14 K17 Q18 R20 L22 W25 I26 R29 T30 N37 K39
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8bqd, PDBe:8bqd, PDBj:8bqd
PDBsum8bqd
PubMed37079644
UniProtP04650|RL39_YEAST Large ribosomal subunit protein eL39 (Gene Name=RPL39)

[Back to BioLiP]