Structure of PDB 7qi5 Chain AL

Receptor sequence

>7qi5AL (length=174) Species: 9606 (Homo sapiens)

LDDDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFM
KKIVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQ
RKKMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIR
VFQETQKLKKRRRALKAAAAAQKQ

3D structure

• PDB: 7qi5 Structure of mitoribosome reveals mechanism of mRNA binding, tRNA interactions with L1 stalk, roles of cofactors and rRNA modifications.
• Chain: AL
• Resolution: 2.63 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	N99 K100 K101 R123 R128 K135 Y139 H142 H146 D149 K150 H152 K153 R154 Y155 L157 M158 S159 D161 Q162 K165 M166 K168 Y195 Y196 R197 R198 H200 R201 R202 F203 K206 K207 C210 F214	N37 K38 K39 R61 R66 K73 Y77 H80 H84 D87 K88 H90 K91 R92 Y93 L95 M96 S97 D99 Q100 K103 M104 K106 Y133 Y134 R135 R136 H138 R139 R140 F141 K144 K145 C148 F152
BS02	NAD	AL	Y195 Y196	Y133 Y134

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7qi5, PDBe:7qi5, PDBj:7qi5
• PDBsum: 7qi5
• PubMed: 38769321
• UniProt: P82914|RT15_HUMAN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)