Structure of PDB 7pil Chain AL

Receptor sequence
>7pilAL (length=55) Species: 272943 (Cereibacter sphaeroides 2.4.1) [Search protein sequence]
MSKFYKIWMIFDPRRVFVAQGVFLFLLAVMIHLILLSTPSYNWLEISAAK
YNRVA
3D structure
PDB7pil Cryo-EM structure of the monomeric Rhodobacter sphaeroides RC-LH1 core complex at 2.5 angstrom.
ChainAL
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO AL H32 L33 H32 L33
BS02 BCL AL L24 F25 H32 W43 L24 F25 H32 W43
BS03 SPO AL F17 Q20 L24 F17 Q20 L24
BS04 SPO AL K6 I7 K6 I7
BS05 BCL AL L27 A28 I31 H32 Y41 L27 A28 I31 H32 Y41
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pil, PDBe:7pil, PDBj:7pil
PDBsum7pil
PubMed34590677
UniProtQ3J1A4|LHA1_CERS4 Light-harvesting protein B-875 alpha chain (Gene Name=pufA)

[Back to BioLiP]