Structure of PDB 7mpj Chain AL

Receptor sequence

>7mpjAL (length=193) Species: 4932 (Saccharomyces cerevisiae)

AISKNLPILKNHFRKHWQERVKVHFDQAGKKVSRRNARATRAAKIAPRPL
DLLRPVVRAPTVKYNRKVRAGRGFTLAEVKAAGLTAAYARTIGIAVDHRR
QNRNQEIFDANVQRLKEYQSKIIVFPRNGKAPEAEQVLSAAATFPIAQPA
TDVEARAVQDNGESAFRTLRLARSEKKFRGIREKRAREKAEAE

3D structure

• PDB: 7mpj CryoEM structures of pseudouridine-free ribosome suggest impacts of chemical modifications on ribosome conformations.
• Chain: AL
• Resolution: 2.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	I3 K5 L7 P8 L10 K11 N12 H13 F14 R15 K16 H17 W18 Q28 A29 K31 K32 R35 R36 R39 R42 R55 V58 R59 P61 T62 Y65 N66 R70 G72 R73 R91 D98 H99 R100 R101 R104 R128 K131 R168 R171 R174 K178 F179 G181 K185	I2 K4 L6 P7 L9 K10 N11 H12 F13 R14 K15 H16 W17 Q27 A28 K30 K31 R34 R35 R38 R41 R54 V57 R58 P60 T61 Y64 N65 R69 G71 R72 R90 D97 H98 R99 R100 R103 R127 K130 R167 R170 R173 K177 F178 G180 K184
BS02	rna	AL	F26 D27 K31	F25 D26 K30
BS03	MG	AL	G30 K31 S34	G29 K30 S33

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7mpj, PDBe:7mpj, PDBj:7mpj
• PDBsum: 7mpj
• PubMed: 35489333
• UniProt: Q12690|RL13A_YEAST Large ribosomal subunit protein eL13A (Gene Name=RPL13A)