Structure of PDB 6zto Chain AL

Receptor sequence

>6ztoAL (length=122) Species: 562 (Escherichia coli) [Search protein sequence]

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPK

3D structure

PDB

6zto Structural basis of transcription-translation coupling and collision in bacteria.

Chain

Resolution

3.0 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	N5 Q6 L7 R9 R12 A13 R14 K15 K18 A26 C27 P28 Q29 K30 R31 K43 K44 N46 S47 A48 R50 K51 T58 Y66 G68 E70 L81 R83 G84 R86 K88 X89 P91 R94 R110 K111 Q112 A113 R114 S115 K116 G118 V119 K120 R121	N4 Q5 L6 R8 R11 A12 R13 K14 K17 A25 C26 P27 Q28 K29 R30 K42 K43 N45 S46 A47 R49 K50 T57 Y65 G67 E69 L80 R82 G83 R85 K87 X88 P90 R93 R109 K110 Q111 A112 R113 S114 K115 G117 V118 K119 R120
BS02	MG	AL	P45 N46	P44 N45

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0034336	misfolded RNA binding

	Biological Process
GO:0000372	Group I intron splicing
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033120	positive regulation of RNA splicing
GO:0034337	RNA folding
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6zto, PDBe:6zto, PDBj:6zto
PDBsum	6zto
PubMed	32820062
UniProt	P0A7S3\|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)