Structure of PDB 6ztn Chain AL

Receptor sequence

>6ztnAL (length=122) Species: 562 (Escherichia coli) [Search protein sequence]

ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPK

3D structure

PDB

6ztn Structural basis of transcription-translation coupling and collision in bacteria.

Chain

Resolution

3.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	N5 Q6 R9 R12 A13 R14 K15 K18 A26 C27 P28 Q29 R31 K43 K44 N46 S47 A48 R50 E70 G84 R86 K88 X89 P91 G92 R94 R110 Q112 A113 R114 S115 K116 R121	N4 Q5 R8 R11 A12 R13 K14 K17 A25 C26 P27 Q28 R30 K42 K43 N45 S46 A47 R49 E69 G83 R85 K87 X88 P90 G91 R93 R109 Q111 A112 R113 S114 K115 R120
BS02	MG	AL	K44 P45 N46	K43 P44 N45

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0019843	rRNA binding
GO:0034336	misfolded RNA binding

	Biological Process
GO:0000372	Group I intron splicing
GO:0002181	cytoplasmic translation
GO:0006412	translation
GO:0033120	positive regulation of RNA splicing
GO:0034337	RNA folding
GO:0046677	response to antibiotic
GO:1990145	maintenance of translational fidelity

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:6ztn, PDBe:6ztn, PDBj:6ztn
PDBsum	6ztn
PubMed	32820062
UniProt	P0A7S3\|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)