Structure of PDB 6zsa Chain AL

Receptor sequence

>6zsaAL (length=164) Species: 9606 (Homo sapiens) [Search protein sequence]

DPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKKI
VANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRKK
MLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVFQ
ETQKLKKRRRALKA

3D structure

PDB

6zsa Structural basis of mitochondrial translation.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	N99 K101 T122 R123 R128 L132 K135 Y139 H142 H146 R147 K150 H152 R154 Y155 L157 M158 D161 Q162 K165 K168 Y195 Y196 R197 R198 H200 R201 R202 F203 K206 K207 C210 F214 K222	N34 K36 T57 R58 R63 L67 K70 Y74 H77 H81 R82 K85 H87 R89 Y90 L92 M93 D96 Q97 K100 K103 Y130 Y131 R132 R133 H135 R136 R137 F138 K141 K142 C145 F149 K157

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding

	Biological Process
GO:0006412	translation
GO:0032543	mitochondrial translation

	Cellular Component
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005739	mitochondrion
GO:0005743	mitochondrial inner membrane
GO:0005759	mitochondrial matrix
GO:0005761	mitochondrial ribosome
GO:0005763	mitochondrial small ribosomal subunit
GO:0005840	ribosome
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6zsa, PDBe:6zsa, PDBj:6zsa
PDBsum	6zsa
PubMed	32812867
UniProt	P82914\|RT15_HUMAN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)

[Back to BioLiP]