Structure of PDB 6vmi Chain AL

Receptor sequence

>6vmiAL (length=174) Species: 9606 (Homo sapiens)

DDPPPSTLLKDYQNVPGIEKVDDVVKRLLSLEMANKKEMLKIKQEQFMKK
IVANPEDTRSLEARIIALSVKIRSYEEHLEKHRKDKAHKRYLLMSIDQRK
KMLKNLRNTNYDVFEKICWGLGIEYTFPPLYYRRAHRRFVTKKALCIRVF
QETQKLKKRRRALKAAAAAQKQAK

3D structure

• PDB: 6vmi Structures of the human mitochondrial ribosome bound to EF-G1 reveal distinct features of mitochondrial translation elongation.
• Chain: AL
• Resolution: 2.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	N98 K99 K100 R127 K134 Y138 H141 H145 K147 K149 R153 Y154 M157 D160 Q161 K167 P191 Y194 Y195 R196 H199 R201 F202 K205 K206 C209 F213 Q217 R223	N35 K36 K37 R64 K71 Y75 H78 H82 K84 K86 R90 Y91 M94 D97 Q98 K104 P128 Y131 Y132 R133 H136 R138 F139 K142 K143 C146 F150 Q154 R160

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding

Biological Process

• GO:0006412 translation
• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005759 mitochondrial matrix
• GO:0005761 mitochondrial ribosome
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6vmi, PDBe:6vmi, PDBj:6vmi
• PDBsum: 6vmi
• PubMed: 32737313
• UniProt: P82914|RT15_HUMAN Small ribosomal subunit protein uS15m (Gene Name=MRPS15)