Structure of PDB 6hhq Chain AL

Receptor sequence
>6hhqAL (length=77) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
AREITDIKQFLELTRRADVKTATVKINKKLNKAGKPFRQTKFKVRGSSSL
YTLVINDAGKAKKLIQSLPPTLKVNRL
3D structure
PDB6hhq Understanding the role of intermolecular interactions between lissoclimides and the eukaryotic ribosome.
ChainAL
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL A2 R3 E4 R17 D19 K26 N28 K42 K44 R46 S48 S49 S50 L51 T53 A1 R2 E3 R16 D18 K25 N27 K41 K43 R45 S47 S48 S49 L50 T52
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0022618 protein-RNA complex assembly
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hhq, PDBe:6hhq, PDBj:6hhq
PDBsum6hhq
PubMed30759226
UniProtP49167|RL38_YEAST Large ribosomal subunit protein eL38 (Gene Name=RPL38)

[Back to BioLiP]