Structure of PDB 6gq1 Chain AL

Receptor sequence
>6gq1AL (length=87) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MENDKGQLVELYVPRKCSATNRIIKADDHASVQINVAKVDEEGRAIPGEY
VTYALSGYVRSRGESDDSLNRLAQNDGLLKNVWSYSR
3D structure
PDB6gq1 Structural Insights into the Role of Diphthamide on Elongation Factor 2 in mRNA Reading-Frame Maintenance.
ChainAL
Resolution4.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna AL Y58 R62 Y58 R62
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000461 endonucleolytic cleavage to generate mature 3'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:6gq1, PDBe:6gq1, PDBj:6gq1
PDBsum6gq1
PubMed29886014
UniProtP0C0V8|RS21A_YEAST Small ribosomal subunit protein eS21A (Gene Name=RPS21A)

[Back to BioLiP]