Structure of PDB 5a9z Chain AL

Receptor sequence
>5a9zAL (length=122) Species: 300852 (Thermus thermophilus HB8) [Search protein sequence]
MIQPQTYLEVADNTGARKIMCIRVLKGSNAKYATVGDVIVASVKEAIPRG
AVKEGDVVKAVVVRTKKEVKRPDGSAIRFDDNAAVIINNQLEPRGTRVFG
PVARELREKGFMKIVSLAPEVL
3D structure
PDB5a9z Structure of Bipa in GTP Form Bound to the Ratcheted Ribosome.
ChainAL
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL M1 I2 Q3 Q5 T6 Y7 I22 R23 K26 G27 S28 N29 K31 Y32 T65 K66 K67 D81 M1 I2 Q3 Q5 T6 Y7 I22 R23 K26 G27 S28 N29 K31 Y32 T65 K66 K67 D81
BS02 rna AL R49 R94 P101 L106 M112 V115 S116 P119 E120 R49 R94 P101 L106 M112 V115 S116 P119 E120
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5a9z, PDBe:5a9z, PDBj:5a9z
PDBsum5a9z
PubMed26283392
UniProtQ5SHP8|RL14_THET8 Large ribosomal subunit protein uL14 (Gene Name=rplN)

[Back to BioLiP]