Structure of PDB 4v9g Chain AL

Receptor sequence

>4v9gAL (length=281) Species: 1063 (Cereibacter sphaeroides) [Search protein sequence]

ALLSFERKYRVPGGTLVGGNLFDFWVGPFYVGFFGVATFFFAALGIILIA
WSAVLQGTWNPQLISVYPPALEYGLGGAPLAKGGLWQIITICATGAFVSW
ALREVEICRKLGIGYHIPFAFAFAILAYLTLVLFRPVMMGAWGYAFPYGI
WTHLDWVSNTGYTYGNFHYNPAHMIAISFFFTNALALALHGALVLSAANP
EKGKEMRTPDHEDTFFRDLVGYSIGTLGIHRLGLLLSLSAVFFSALCMII
TGTIWFDQWVDWWQWWVKLPWWANIPGGING

3D structure

PDB

4v9g Three-Dimensional Structure of the Rhodobacter sphaeroides RC-LH1-PufX Complex: Dimerization and Quinone Channels Promoted by PufX.

Chain

Resolution

7.78 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	BCL	AL	F97 F121 A124 A127 V157 G161 Y162 H168 H173 I177 F181 S244 M248	F97 F121 A124 A127 V157 G161 Y162 H168 H173 I177 F181 S244 M248
BS02	BCL	AL	I46 I49 Y128 F146 H153 V157	I46 I49 Y128 F146 H153 V157
BS03	BPH	AL	F41 G45 A96 W100 A120 F121 Y148 S237 L238	F41 G45 A96 W100 A120 F121 Y148 S237 L238
BS04	U10	AL	I175 S178 F179 T182 A186 L189 H190 F216 Y222 I229 L232 F243 I250	I175 S178 F179 T182 A186 L189 H190 F216 Y222 I229 L232 F243 I250
BS05	BCL	AL	M174 I177 F181	M174 I177 F181
BS06	BPH	AL	F181 A184 L185 L189	F181 A184 L185 L189
BS07	FE2	AL	H190 H230	H190 H230
BS08	U10	AL	V31 G35	V31 G35

Gene Ontology

	Molecular Function
GO:0042314	bacteriochlorophyll binding
GO:0045156	electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872	metal ion binding

	Biological Process
GO:0009772	photosynthetic electron transport in photosystem II
GO:0015979	photosynthesis
GO:0019684	photosynthesis, light reaction

	Cellular Component
GO:0016020	membrane
GO:0030077	plasma membrane light-harvesting complex
GO:0042717	plasma membrane-derived chromatophore membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4v9g, PDBe:4v9g, PDBj:4v9g
PDBsum	4v9g
PubMed	24131108
UniProt	P0C0Y8\|RCEL_CERSP Reaction center protein L chain (Gene Name=pufL)

[Back to BioLiP]