Structure of PDB 4v75 Chain AL

Receptor sequence
>4v75AL (length=123) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
ATVNQLVRKPRARKVAKSNVPALEACPQKRGVCTRVYTTTPKKPNSALRK
VCRVRLTNGFEVTSYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVRGA
LDCSGVKDRKQARSKYGVKRPKA
3D structure
PDB4v75 Energy barriers and driving forces in tRNA translocation through the ribosome.
ChainAL
Resolution12.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL A1 N4 R8 K9 R11 A12 R13 K14 A25 P27 Q28 R30 P44 N45 S46 A47 L48 R82 K87 D88 G99 K110 A112 R113 S114 G117 V118 K119 R120 A1 N4 R8 K9 R11 A12 R13 K14 A25 P27 Q28 R30 P44 N45 S46 A47 L48 R82 K87 D88 G99 K110 A112 R113 S114 G117 V118 K119 R120
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0034336 misfolded RNA binding
Biological Process
GO:0000372 Group I intron splicing
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0033120 positive regulation of RNA splicing
GO:0034337 RNA folding
GO:0046677 response to antibiotic
GO:1990145 maintenance of translational fidelity
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v75, PDBe:4v75, PDBj:4v75
PDBsum4v75
PubMed24186064
UniProtP0A7S3|RS12_ECOLI Small ribosomal subunit protein uS12 (Gene Name=rpsL)

[Back to BioLiP]