Structure of PDB 4v6u Chain AL

Receptor sequence
>4v6uAL (length=102) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
MQKARIKIASTNVRSLDEVANQIKQIAERTGVRMSGPIPLPTKRIRITTR
KSPDGEGSATFDRWELRVHKRLIDIEADERAMRQIMRIRVPEDVTIEIEL
IS
3D structure
PDB4v6u Promiscuous behaviour of archaeal ribosomal proteins: Implications for eukaryotic ribosome evolution.
ChainAL
Resolution6.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna AL P37 I38 L40 T48 T49 R50 S52 D54 G55 E56 G57 S58 H69 R71 D74 P37 I38 L40 T48 T49 R50 S52 D54 G55 E56 G57 S58 H69 R71 D74
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4v6u, PDBe:4v6u, PDBj:4v6u
PDBsum4v6u
PubMed23222135
UniProtP61885|RS10_PYRFU Small ribosomal subunit protein uS10 (Gene Name=rps10)

[Back to BioLiP]