Structure of PDB 4v6o Chain AL

Receptor sequence

>4v6oAL (length=129) Species: 562 (Escherichia coli)

AENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQP
LELVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKA
GFVTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 4v6o Structural characterization of mRNA-tRNA translocation intermediates.
• Chain: AL
• Resolution: 14.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	A1 E2 N3 Q4 Y6 T8 R10 K12 S13 A15 R17 F19 Q31 Q36 Y37 G39 R40 E41 K67 G68 G69 G70 Q74 R84 R94 R98 K99 T104 R105 R108 Q109 V110 E111 R112 K113 K114 V115 G116 L117 R118 K119 R121 R122 R123 Q125 F126 S127 K128 R129	A1 E2 N3 Q4 Y6 T8 R10 K12 S13 A15 R17 F19 Q31 Q36 Y37 G39 R40 E41 K67 G68 G69 G70 Q74 R84 R94 R98 K99 T104 R105 R108 Q109 V110 E111 R112 K113 K114 V115 G116 L117 R118 K119 R121 R122 R123 Q125 F126 S127 K128 R129

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:4v6o, PDBe:4v6o, PDBj:4v6o
• PDBsum: 4v6o
• PubMed: 22467828
• UniProt: P0A7X3|RS9_ECOLI Small ribosomal subunit protein uS9 (Gene Name=rpsI)