Structure of PDB 4v4p Chain AL

Receptor sequence

>4v4pAL (length=133) Species: 300852 (Thermus thermophilus HB8)

QIKLQLPAGKATPAPPVGPALGQHGVNIMEFCKRFNAETADKAGMILPVV
ITVYEDKSFTFIIKTPPASFLLKKAAGIEKGSSEPKRKIVGKVTRKQIEE
IAKTKMPDLNANSLEAAMKIIEGTAKSMGIEVV

3D structure

• PDB: 4v4p Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.
• Chain: AL
• Resolution: 5.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	Q12 H31 P74 A75 S76 F77 K87 G88 S90 E91 P92 K93 R94 K112 D115 N117 A118 A123 K126 I127 E129 G130 T131 S134 M135	Q5 H24 P67 A68 S69 F70 K80 G81 S83 E84 P85 K86 R87 K105 D108 N110 A111 A116 K119 I120 E122 G123 T124 S127 M128

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Mar 9 08:54:14 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4v4p', asym_id = 'AL', title = 'Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4v4p', asym_id='AL', title='Translational operator of mRNA on the ribosome: how repressor proteins exclude ribosome binding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003735,0005840,0006412', uniprot = '', pdbid = '4v4p', asym_id = 'AL'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003735,0005840,0006412', uniprot='', pdbid='4v4p', asym_id='AL')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>