Structure of PDB 3jbp Chain AL

Receptor sequence

>3jbpAL (length=211) Species: 36329 (Plasmodium falciparum 3D7) [Search protein sequence]

VAHNNVLPNVHLHKWWQHRVRVNFSKNIKKKKRRLLREKRRKANGGTPIE
KLHPIVHCPTQRYNFRTRLGKGFTFEELKGAGLTPRAAQTIGICYDKRRK
NRSEESLTKNVERLLKYKNSLVMIPLKKNKAKKGIGGIPADADKNTIKEF
RNKKPLLSIFKKEKNTKPFYETIEVSKIDKEFLAYKTLRRAKLAERRKNC
RQQKKDIKFKS

3D structure

PDB

3jbp Dynamical features of the Plasmodium falciparum ribosome during translation.

Chain

Resolution

6.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AL	V2 A3 H4 N6 N10 H12 H14 K15 W17 Q18 R22 K27 N28 K30 K31 K32 R34 R35 R38 R41 K52 V57 H58 C59 P60 T61 R63 Y64 N65 F66 R67 R69 G71 K72 K80 K98 R99 R100 K101 R103 S104 K128 K129 K133 K134 G135 I136 K145 K149 R152 K163 K168 L184 Y186 K187 R190 R191 K193 R197 R198 Q204 K205 K206 F210 K211	V1 A2 H3 N5 N9 H11 H13 K14 W16 Q17 R21 K26 N27 K29 K30 K31 R33 R34 R37 R40 K51 V56 H57 C58 P59 T60 R62 Y63 N64 F65 R66 R68 G70 K71 K79 K97 R98 R99 K100 R102 S103 K127 K128 K132 K133 G134 I135 K144 K148 R151 K162 K167 L183 Y185 K186 R189 R190 K192 R196 R197 Q203 K204 K205 F209 K210

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3jbp, PDBe:3jbp, PDBj:3jbp
PDBsum	3jbp
PubMed	26432834
UniProt	Q8IAX6

[Back to BioLiP]