Structure of PDB 8q5i Chain AK

Receptor sequence

>8q5iAK (length=86) Species: 5476 (Candida albicans) [Search protein sequence]

GKGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWAL
KAKRRRTTGTGRMAYLKHVTRRFKNGFQTGVAKAQT

3D structure

PDB

8q5i Structural characterization of cephaeline binding to the eukaryotic ribosome using Cryo-Electron Microscopy

Chain

Resolution

2.45 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	AK	G2 K3 G4 T5 P6 S7 L8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 K31 S35 K43 M44 R45 H47 N48 W49 K52 R55 R56 T58 T71	G1 K2 G3 T4 P5 S6 L7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 K30 S34 K42 M43 R44 H46 N47 W48 K51 R54 R55 T57 T70
BS02	rna	AK	R21 C22 V29 T59 G60 G62 R63 M64 Y66 L67 K68 V70 R72 F74 K75 N76 Q79 G81 V82 A83 Q86	R20 C21 V28 T58 G59 G61 R62 M63 Y65 L66 K67 V69 R71 F73 K74 N75 Q78 G80 V81 A82 Q85
BS03	K16	AK	T59 R63 M64 K68	T58 R62 M63 K67
BS04	ZN	AK	C19 C22 C34 C37	C18 C21 C33 C36

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding
GO:0046872	metal ion binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8q5i, PDBe:8q5i, PDBj:8q5i
PDBsum	8q5i
PubMed
UniProt	A0A1D8PF45\|RL37B_CANAL Large ribosomal subunit protein eL37 (Gene Name=RPL37B)