Structure of PDB 8ove Chain AK

Receptor sequence

>8oveAK (length=142) Species: 5702 (Trypanosoma brucei brucei) [Search protein sequence]

HTLKQVQTFGKKKTAIAVATVTKAPQCNIRINGVPISQILPETLRAKIME
AVKVVGARYFSRLRVDVRVRGSGQVAQAYAVRQAIAKGIIAYYQKYHNEI
EKAALKDKYLEYDKFLLIADPRRCEPKKWGRHSARTRFTKSY

3D structure

PDB

8ove A single pseudouridine on rRNA regulates ribosome structure and function in the mammalian parasite Trypanosoma brucei.

Chain

Resolution

2.6 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	H7 Q11 Q13 K18 K19 T20 Q32 C33 I42 S67 R68 G77 S78 G79 Q80 V81 A82 K120 I124 P127 R128 R129 C130 E131 K133 K134 W135 R137 R141 T142 T145 K146 S147	H1 Q5 Q7 K12 K13 T14 Q26 C27 I36 S61 R62 G71 S72 G73 Q74 V75 A76 K114 I118 P121 R122 R123 C124 E125 K127 K128 W129 R131 R135 T136 T139 K140 S141

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000462	maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links