Structure of PDB 8cre Chain AK

Receptor sequence

>8creAK (length=86) Species: 5476 (Candida albicans)

GKGTPSLGKRHNKSHTLCNRCGRRSFHVQKKTCSSCGYPAAKMRSHNWAL
KAKRRRTTGTGRMAYLKHVTRRFKNGFQTGVAKAQT

3D structure

• PDB: 8cre Drug-induced rotational movement of the ribosome is a key factor for read-through enhancement
• Chain: AK
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	AK	G2 K3 G4 T5 P6 S7 L8 G9 K10 R11 H12 N13 K14 S15 H16 R24 R25 S26 H28 Q30 S35 K43 M44 R45 H47 N48 W49 K52 R55 R56 T58 K75 N76 Q86	G1 K2 G3 T4 P5 S6 L7 G8 K9 R10 H11 N12 K13 S14 H15 R23 R24 S25 H27 Q29 S34 K42 M43 R44 H46 N47 W48 K51 R54 R55 T57 K74 N75 Q85
BS02	rna	AK	R21 C22 G23 V29 Y39 A42 T59 G60 T61 G62 R63 M64 Y66 L67 K68 R72 F74 K75 N76 Q79 G81 V82 A83 A85	R20 C21 G22 V28 Y38 A41 T58 G59 T60 G61 R62 M63 Y65 L66 K67 R71 F73 K74 N75 Q78 G80 V81 A82 A84
BS03	ZN	AK	C19 C22 C34 C37	C18 C21 C33 C36

External links

• PDB: RCSB:8cre, PDBe:8cre, PDBj:8cre
• PDBsum: 8cre
• UniProt: A0A1D8PF45|RL37B_CANAL Large ribosomal subunit protein eL37 (Gene Name=RPL37B)